I have some protein sequences and I want to build a position-specific scoring matrix (PSSM) for them and then upload this PSSM to NCBI PSI-BLAST. I used CHAPS program for this pupose but uploading the output PSSM gave me an error in NCBI PSI-BLAST. Do you know any tool or webserver for getting PSSMs for a group of protein sequences which then can work in NCBI PSI-BLAST? This is a part of my PSSM file:
PssmWithParameters ::= {
pssm {
isProtein TRUE ,
numRows 28 ,
numColumns 131 ,
byRow FALSE ,
query
seq {
id {
other {
accession "WP_000208753" } } ,
inst {
repr raw ,
mol aa ,
length 131 ,
seq-data
ncbieaa "MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAW
AGFIDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW" } } ,
intermediateData {
freqRatios {
{ 0, 10, 0 } ,
{ 564418841, 10, -10 } ,
{ 0, 10, 0 } ,
{ 11768571, 10, -9 } ,
{ 185838265, 10, -10 } ,
{ 31496547, 10, -9 } ,
{ 3872857, 10, -8 } ,
{ 291750464, 10, -10 } ,
{ 128450763, 10, -10 } ,
{ 759856221, 10, -10 } ,
{ 359173937, 10, -10 } ,
{ 179865517, 10, -9 } ,
{ 14537895, 10, -8 } ,
{ 212921456, 10, -10 } ,
{ 220554141, 10, -10 } ,
{ 368516324, 10, -10 } ,
{ 319343525, 10, -10 } ,
{ 426173953, 10, -10 } ,
{ 463659523, 10, -10 } ,
{ 817322186, 10, -10 } ,
{ 811693964, 10, -11 } ,
{ 0, 10, 0 } ,
{ 227810064, 10, -10 } ,
{ 0, 10, 0 } ,
{ 0, 10, 0 } ,
{ 0, 10, 0 } ,
{ 0, 10, 0 } ,
{ 0, 10, 0 } ,
{ 0, 10, 0 } ,
{ 768325726, 10, -10 } ,
{ 0, 10, 0 } ,
{ 1425562, 10, -8 } ,
{ 372685285, 10, -10 } ,
{ 466727421, 10, -10 } ,
{ 185741084, 10, -10 } ,
{ 427328646, 10, -10 } ,
{ 122594965, 10, -10 } ,
{}) which uses a fixed-width font. – terdon Jun 30 '17 at 16:10