2

The question of how one can extract the longest isoform per gene from a multi-fasta file has been answered expertly in this thread: How can longest isoforms (per gene) be extracted from a FASTA file?

I wonder: how can the python script "filter.py" by Devon Ryan, that is marked as best answer, be modified so that it extracts the N longest isoform sequences per gene instead of only the single longest isoform?

Any help on this to a python novice is very much appreciated.

Here is an example of how the data looks (two genes with 5 isoformes each, and I need the 3 longest isoforms for each gene):

>Animal1|gene000001_1  
TTLQLLNELVLLLHYTTLLLHTKKTKESTINNYFKQKEQK  
>Animal1|gene000001_2  
CYYYTTQHYYYIQKKQKNLQSTITSNKKNKNKHAK  
>Animal1|gene000001_3  
ARDMLDYTTTTKRVSATTTLHNTTTTYKKNKRIYNQQLLQTKRTKISMQNKNLNQINYKK  
LQETTEKHAK  
>Animal1|gene000001_4  
HHAVNFQPMSEATGIYLNSTEIRNSLLQYSSWSWFTFHTCKLWNVTF  
>Animal1|gene000001_5  
EILCYSIPPGVGLLFTPVNFGMLRSKLIKVRILDIINFNCSLLICLPPYLFQIDVGEDKD  
DPVVEIVLYLACSI  
>Animal1|gene000002_1  
TTLQLLNELVLLLHYTTLLLHTKKTKESTINNYFKQKEQK  
>Animal1|gene000002_2  
CYYYTTQHYYYIQKKQKNLQSTITSNKKNKNKHAK  
>Animal1|gene000002_3  
ARDMLDYTTTTKRVSATTTLHNTTTTYKKNKRIYNQQLLQTKRTKISMQNKNLNQINYKK  
LQETTEKHAK  
>Animal1|gene000002_4  
LCSAVARQKTKSRKYDATVDTCFSNIKININVLSFSLIVNPKYSKVSYQYGTNDAFRKFF  
ITSRSLR  
>Animal1|gene000002_5  
ETLEYFGLTINEKESTLILILMLLKQVSTVASYFLDLVFCLATALHS  

As output, I would like to have a fasta file like the following:

>Animal1|gene000001_5  
EILCYSIPPGVGLLFTPVNFGMLRSKLIKVRILDIINFNCSLLICLPPYLFQIDVGEDKD  
DPVVEIVLYLACSI  
>Animal1|gene000001_3  
ARDMLDYTTTTKRVSATTTLHNTTTTYKKNKRIYNQQLLQTKRTKISMQNKNLNQINYKK  
LQETTEKHAK  
>Animal1|gene000001_4  
HHAVNFQPMSEATGIYLNSTEIRNSLLQYSSWSWFTFHTCKLWNVTF  
>Animal1|gene000002_3  
ARDMLDYTTTTKRVSATTTLHNTTTTYKKNKRIYNQQLLQTKRTKISMQNKNLNQINYKK  
LQETTEKHAK  
>Animal1|gene000002_4  
LCSAVARQKTKSRKYDATVDTCFSNIKININVLSFSLIVNPKYSKVSYQYGTNDAFRKFF  
ITSRSLR  
>Animal1|gene000002_5  
ETLEYFGLTINEKESTLILILMLLKQVSTVASYFLDLVFCLATALHS  
terdon
  • 10,071
  • 5
  • 22
  • 48
Pedro
  • 23
  • 4
  • Please [edit] your question and include an example of your fasta file so we don't need to guess from the other question. – terdon Dec 20 '18 at 15:21
  • I can do this but it would be entirely different code, you are grouping objects by name and reporting 3 of each name that are the longest. Would you like me to write you a code that handled this a different way? Also, can you use the pandas library? – d_kennetz Dec 20 '18 at 23:16
  • Thanks for your answer, d_kennetz; I did not expect that entirely different code would be necessary, but simply thought that adding one or two statements to the existing python script would be the easiest way to do the job. I can understand the suggestion of fin swimmer (see below) and it does exactly what I need, so it is not necessary that you write extra code for me. Thanks for your help. – Pedro Dec 21 '18 at 10:30

2 Answers2

1

I know you are asking for a python solution. But maybe you are interested in other ways.

You can use samtools faidx to index your fasta file. The resulting file contains the information about the length of every sequence. We can sort by length and extract the first n transcripts per gene.

1. Index fasta

samtools faidx input.fa

2. Extract IDs of the n longest transcripts per gene

sed 's/_.\+//g' input.fa.fai | sort -u | 
    parallel -k 'grep {} -m 3 <(sort -k2,2 -r --sort g input.fa.fai) |
        cut -f1' > longestID.txt

The sed command replaces everything from _ onwards in each line, leaving behind only the gene name. sort -u is used to get a list of distinct gene names. For each of theses gene names we grep for the first 3 matches in the descending sorted by length index file. As we just want the sequence ids, we select only the first column with cut. Adopt the -m parameter if you want more or fewer transcripts.

3. Get sequences

samtools faidx input.fa -r longestID.txt > output.fa
terdon
  • 10,071
  • 5
  • 22
  • 48
finswimmer
  • 1,342
  • 7
  • 15
  • Thanks for your suggestion, fin swimmer; this solution is elegant and completely fine with me (and I can understand it!). I just thought that modifying the python code would be easier. I didn't know that the samtools index can be used like this, and also learned from your answer about the parallel -k and the grep -m parameters. Thank you for your help and solving my problem. – Pedro Dec 21 '18 at 10:35
0

Here a python solution:

#!/usr/bin/env python
from __future__ import print_function
from Bio import SeqIO
from argparse import ArgumentParser


def main():
    args = get_args()
    last_gene = None
    transcripts = []

    for record in SeqIO.parse(args.input, "fasta"):
        gene = record.id.split("_")[0]

        if last_gene is None:
            last_gene = gene

        if last_gene == gene:
            transcripts.append(record)
        else:
            print_longest_transcripts(transcripts, args.number)
            last_gene = gene
            transcripts = [record]

    print_longest_transcripts(transcripts, args.number)


def print_longest_transcripts(transcripts, number):
    longest = sorted(transcripts, key=lambda x: len(x.seq), reverse=True)

    for record in longest[:number]:
        print(">"+record.id, record.seq, sep="\n")


def get_args():
    parser = ArgumentParser(description="")
    parser.add_argument("-i", "--input", help="input fasta", required=True)
    parser.add_argument("-n", "--number", help="number of longest transcript per gene", type=int, required=True)
    return parser.parse_args()


if __name__ == '__main__':
    main()

Run it like this:

python longest.py -i input.fasta -n 3
finswimmer
  • 1,342
  • 7
  • 15
  • wow, thanks, finswimmer, for this script; although I liked the samtools solution, this python code is superior because it runs on one of my input files in 0m 1.857s while the samtools commands took almost 2h for writing the list "longestID.txt" for the same input file. A small suggestion: Because we want fasta formatted output, we could add to line no. 33 a fasta hook, like this: print(">"+record.id, record.seq, sep="\n") – Pedro Dec 21 '18 at 14:01
  • You're right with your suggestion. I missed it and edited my answer. I'm surprised that the python solution is faster here. Would be interesting to find the bottleneck in the samtools version. You could try increasing the number of parallel jobs by applying the -j parameter for parallels e.g. -j 8. – finswimmer Dec 21 '18 at 14:06