I want to create a database for a proteomics study. Therefore, the mapping from a given sequence to a protein ID has to be unique. I am wondering whether there is already a built-in function in Biopython for that, but I could not find any. The duplicated sequences should be merged into a single entry and there respective IDs should be just concatenated (see expected outcome below).
Using the following example input
>prot_id_1
MAWIGLDISKLFVENSRDAAA
>prot_id_2
MENVSRIWRYQQRRVLSRAFTHWYLMGLTKHNHPS
>prot_id_3
MRTRPSRDFHYIVGRITRESPEEKGIFYVFH
>prot_id_4
MEMVLSSANPSTTFADSYVV
>prot_id_5
MAWIGLDISKLFVENSRDAAA
>prot_id_6
MENVSRIWRYQQRRVLSRAFTHWYLMGLTKHNHPS
>prot_id_7
MAWIGLDISKLFVENSRDAAA
I currently do it as follows:
from Bio import SeqIO
import numpy as np
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.Alphabet import IUPAC
# Read entries into dictionary, gi: sequence
record_dict = SeqIO.to_dict(SeqIO.parse("test.fasta", "fasta"))
# Extract sequence as string
record_dict = {gi: str(record_dict[gi].seq) for gi in record_dict}
# Check for duplicated sequences
seq_id_dict = {}
for k, v in record_dict.items():
seq_id_dict.setdefault(v, []).append(k)
# Filter sequences that appear more than once
filter_dict = {seqi: li for seqi, li in seq_id_dict.items() if len(li) > 1}
# Merge identifiers to a single one
merged_ids = {"_".join(sorted(li)): seqi for seqi, li in filter_dict.items()}
# Remove all entries that are associated with duplicate IDs
for gi in set(np.concatenate(filter_dict.values())):
record_dict.pop(gi, None)
# Add the merged IDs again
record_dict.update(merged_ids)
# Create list of Seq objects
final_seq = [SeqRecord(Seq(seqi, IUPAC.protein), id=gi, name='', description='') for gi, seqi in record_dict.items()]
# Write file
SeqIO.write(final_seq, 'test_output.fasta', 'fasta')
which gives me the desired output:
>prot_id_4
MEMVLSSANPSTTFADSYVV
>prot_id_1_prot_id_5_prot_id_7
MAWIGLDISKLFVENSRDAAA
>prot_id_3
MRTRPSRDFHYIVGRITRESPEEKGIFYVFH
>prot_id_2_prot_id_6
MENVSRIWRYQQRRVLSRAFTHWYLMGLTKHNHPS
Is there a smarter way of accomplishing this?
dedup_recordsis the same asseq_id_dict). But true, all the additional filtering is not needed; Friday afternoon... :) – Cleb Nov 10 '17 at 15:52